Hold min sesjon åpen
Slutter 
Sesjonen har utløpt
Økten er utløpt. For sikkerhets skyld har vi logget deg ut. Vil du logge inn på nytt?

Anti-SOS1 Mouse Monoclonal Antibody [clone: 4C1]

Leverandør: US Biological
Type: Primary
Antigen: SOS1 (son of sevenless homolog 1 (Drosophila))
Clonality: monoclonal
Clone: 4C1
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human



Logg inn for å se avtalepris og tilgjengelighet
  Husk meg på denne enheten
 

BESTILL

Utvid alle / Skjul alle
Str Fp Art.nr Antall
100 µg 100 µG USBI133711
Lag barcode etiketter Barcode etikett format: 
Lag PDF katalog

SPESIFIKASJONER

Antigen symbol SOS1
Antigen name son of sevenless homolog 1 (Drosophila)
Reaktivitet Human
Konjugasjon Unconjugated
Klonalitet Monoclonal
antistofftype Primary
Klon 4C1
Vert Mouse
Isotype IgG2a kappa
ELISA Yes
aminosyre nr 313 to 421
Rensing purified by Protein A chromatography
Sekvens SQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK*
Form liquid
Lagringsbuffer PBS, pH 7,2.
Lagringstemp Cool
Frakttemp. Ice
Legg inn detaljer

Velg varen hvor du søker etter sertifikat

Legg inn batchnummer. Legg inn "X" hvis du ikke har informasjonen for VWR Chemicals. Feltet er obligatorisk

Skriv inn serifikatdetaljer

Skriv inn lot nummer:

Velg fra de siste batch / lot tallene:

Eller
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Beskrivelse Art.nr. Availability Enhet Din pris Price Per Antall