Hold min sesjon åpen
Slutter 
Sesjonen har utløpt
Økten er utløpt. For sikkerhets skyld har vi logget deg ut. Vil du logge inn på nytt?

Anti-SOX30 Mouse Monoclonal Antibody [clone: 6H1]

Leverandør: US Biological
Recommended dilution: Immunofluorescence: 10 μg/ml

Type: Primary
Antigen: SOX30 (SRY (sex determining region Y)-box 30)
Clonality: monoclonal
Clone: 6H1
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human



Logg inn for å se avtalepris og tilgjengelighet
  Husk meg på denne enheten
 

BESTILL

Utvid alle / Skjul alle
Str Fp Art.nr Antall
100 µg 100 µG USBI133725
Lag barcode etiketter Barcode etikett format: 
Lag PDF katalog

SPESIFIKASJONER

Antigen symbol SOX30
Antigen name SRY (sex determining region Y)-box 30
Reaktivitet Human
Konjugasjon Unconjugated
Klonalitet Monoclonal
antistofftype Primary
Klon 6H1
Vert Mouse
Isotype IgG2a kappa
Western blot Yes
ELISA Yes
ImmunoFluorescence Yes
aminosyre nr 644 to 754
Rensing purified by Protein A chromatography
Sekvens SMPECLSYYEDRYPKHEGIFSTLNRDYSFRDYSSECTHSENSRSCENMNGTSYYNSHSHSGEENLNPVPQLDIGTLENVFTAPTSTPSSIQQVNVTDSDEEEEEKVLRDL
Form liquid
Lagringsbuffer PBS, pH 7,2.
Lagringstemp Cool
Frakttemp. Ice
Legg inn detaljer

Velg varen hvor du søker etter sertifikat

Legg inn batchnummer. Legg inn "X" hvis du ikke har informasjonen for VWR Chemicals. Feltet er obligatorisk

Skriv inn serifikatdetaljer

Skriv inn lot nummer:

Velg fra de siste batch / lot tallene:

Eller
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Beskrivelse Art.nr. Availability Enhet Din pris Price Per Antall