Hold min sesjon åpen
Slutter 
Sesjonen har utløpt
Økten er utløpt. For sikkerhets skyld har vi logget deg ut. Vil du logge inn på nytt?

Anti-SPG21 Mouse Monoclonal Antibody [clone: 2B11]

Leverandør: US Biological
Type: Primary
Antigen: SPG21 (spastic paraplegia 21 (autosomal recessive, Mast syndrome))
Clonality: monoclonal
Clone: 2B11
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human




 

BESTILL

Utvid alle / Skjul alle
Str Fp Art.nr Antall
100 µg 100 µG USBI133761
Lag barcode etiketter Barcode etikett format: 
Lag PDF katalog

SPESIFIKASJONER

Antigen symbol SPG21
Antigen name spastic paraplegia 21 (autosomal recessive, Mast syndrome)
Reaktivitet Human
Konjugasjon Unconjugated
Klonalitet Monoclonal
antistofftype Primary
Klon 2B11
Vert Mouse
Isotype IgG2a kappa
ELISA Yes
aminosyre nr 211 to 307
Rensing purified by Protein A chromatography
Sekvens PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQE
Form liquid
Lagringsbuffer PBS, pH 7,2.
Lagringstemp Cool
Frakttemp. Ice
Legg inn detaljer

Velg varen hvor du søker etter sertifikat

Legg inn batchnummer. Legg inn "X" hvis du ikke har informasjonen for VWR Chemicals. Feltet er obligatorisk

Skriv inn serifikatdetaljer

Skriv inn lot nummer:

Velg fra de siste batch / lot tallene:

Eller
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Beskrivelse Art.nr. Availability Enhet Din pris Price Per Antall
 

A new look and a renewed commitment

Built on the features & resources you know, optimized with innovation from Avantor®. Our new brand symbolizes agility and our ability to adapt to customer needs.

Learn More Start Shopping