Hold min sesjon åpen
Slutter 
Sesjonen har utløpt
Økten er utløpt. For sikkerhets skyld har vi logget deg ut. Vil du logge inn på nytt?

Anti-ATL1 Mouse Monoclonal Antibody [clone: 1B9]

Leverandør: US Biological
Type: Primary
Antigen: ATL1 (atlastin GTPase 1)
Clonality: monoclonal
Clone: 1B9
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 Kappa
Reactivity: Human, Rat



Logg inn for å se avtalepris og tilgjengelighet
  Husk meg på denne enheten
 

BESTILL

Utvid alle / Skjul alle
Str Fp Art.nr Antall
100 µg 100 µG USBI133762
Lag barcode etiketter Barcode etikett format: 
Lag PDF katalog

SPESIFIKASJONER

Antigen symbol ATL1
Antigen name atlastin GTPase 1
Reaktivitet Human, Rat
Konjugasjon Unconjugated
Klonalitet Monoclonal
antistofftype Primary
Klon 1B9
Vert Mouse
Isotype IgG1 kappa
Western blot Yes
ELISA Yes
aminosyre nr 1 to 101
Rensing purified by Protein A chromatography
Sekvens MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWV
Form liquid
Lagringsbuffer PBS, pH 7,2.
Lagringstemp Cool
Frakttemp. Ice
Legg inn detaljer

Velg varen hvor du søker etter sertifikat

Legg inn batchnummer. Legg inn "X" hvis du ikke har informasjonen for VWR Chemicals. Feltet er obligatorisk

Skriv inn serifikatdetaljer

Skriv inn lot nummer:

Velg fra de siste batch / lot tallene:

Eller
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Beskrivelse Art.nr. Availability Enhet Din pris Price Per Antall