Hold min sesjon åpen
Slutter 
Sesjonen har utløpt
Økten er utløpt. For sikkerhets skyld har vi logget deg ut. Vil du logge inn på nytt?

Anti-H1FX Mouse Monoclonal Antibody

Leverandør: Abnova

Mouse monoclonal antibody raised against a full-length recombinant H1FX.

Type: Primary
Antigen: H1FX
Clonality: Monoclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype:
Reactivity: Human



Logg inn for å se avtalepris og tilgjengelighet
  Husk meg på denne enheten
 

BESTILL

Utvid alle / Skjul alle
Str Fp Art.nr Antall
Up to 5 Clones 1 ABNOH00008971-M
Lag barcode etiketter Barcode etikett format: 
Lag PDF katalog

SPESIFIKASJONER

Antigen symbol H1FX
Antigen name H1 histone family, member X
Reaktivitet Human
Konjugasjon Unconjugated
Klonalitet Monoclonal
antistofftype Primary
Vert Mouse
Western Blot Yes
ELISA Yes
antigen synonymer H1.10, H1X
aminosyre nr 1 to 213
Gen 8971
Format Liquid
Kyssabsorpsjon No
Immunogen H1FX (NP_006017.1, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sekvens MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKKDKGGKAKKTAAAGGKKVKKAAKPSVPKVPKGRK
Legg inn detaljer

Velg varen hvor du søker etter sertifikat

Legg inn batchnummer. Legg inn "X" hvis du ikke har informasjonen for VWR Chemicals. Feltet er obligatorisk

Enter Certificate Details

Select Product:

Enter the Lot number:

Choose from recent batch/lot numbers:

Eller
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Beskrivelse Art.nr. Availability Enhet Din pris Price Per Antall